PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g016240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GATA
Protein Properties Length: 287aa    MW: 32226.9 Da    PI: 7.8579
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g016240.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA50.82.3e-16214248135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C++C tt Tp+WR+gp g  tLCnaCG+++r+ +l
  Csa07g016240.1 214 CTHCETTRTPQWREGPCGRNTLCNACGVRFRSGRL 248
                     *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.5E-15208258IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.939212244IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.104.0E-13212245IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577165.23E-14212271No hitNo description
CDDcd002021.51E-14213262No hitNo description
PfamPF003202.7E-14214248IPR000679Zinc finger, GATA-type
PROSITE patternPS003440214239IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MSNGSWLPEE DFKGLADNFF DNLVEHMDEF PLEDIETADD DEEEDWVTGF KNLGPPPLDV  60
LTSLSSEFNC KVQRVRVHKP ATIVKQSSSS DVSSTVDNSP PDVKVSKLFQ SSSPVSVVDN  120
TTNGSVLSQN QNRIQRLAFL VKGIRSKRKR PTTLRFFQSL GAEMSQHFVP DESESETYLS  180
SESFAKKRKK NKSRPAPSVS SPELFNSDGT VRKCTHCETT RTPQWREGPC GRNTLCNACG  240
VRFRSGRLVP EYRPASSPTF IPTVHSNSHR KIIEMKTRTE RSEHRD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185189KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010414541.10.0PREDICTED: putative GATA transcription factor 13
SwissprotQ9SKN61e-107GAT13_ARATH; Putative GATA transcription factor 13
TrEMBLR0FY421e-157R0FY42_9BRAS; Uncharacterized protein
STRINGscaffold_401176.11e-136(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28340.11e-84GATA transcription factor 13